SMAD3 Polyclonal antibody

• 

  WB analysis using 30130-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30130-1-AP (SMAD3 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse stomach using 30130-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 30130-1-AP (SMAD3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 30130-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30130-1-AP (SMAD3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 30130-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30130-1-AP (SMAD3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat stomach using 30130-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 30130-1-AP (SMAD3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SMAD3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30130-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

hMAD 3, hMAD-3, hSMAD3, HSPC193, HsT17436

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells
• Positive IHC detected in: human stomach cancer tissue, mouse stomach tissue, rat stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30130-1-AP targets SMAD3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32595

  Product name: Recombinant human SMAD3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 145-260 aa of NM_005902

  Sequence: EIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGF

• Full Name: SMAD family member 3
• Calculated Molecular Weight: 48kd
• Observed Molecular Weight: 48-55 kDa
• GenBank Accession Number: NM_005902
• Gene Symbol: SMAD3
• Gene ID (NCBI): 4088
• RRID: AB_3662144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P84022
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMAD3, also named as hMAD 3 or Mad3, is a 425 amino acid protein, which contains one MH1 domain and one MH2 domain. SMAD3 localizes in the nucleus and cytoplasm. SMAD3 plays an essential role in development and maintenance of self-tolerance and is a critical mediator of the TGFB signaling pathway. SMAD3 is involved in TGFB dependent regulation of steroidogenesis and in T-cell response to TGFB.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Clin Endocrinol Metab; CD34+ orbital fibroblasts contribute to the pathogenesis of thyroid eye disease via miR-182-5p; Authors - Baiguang Yu