Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells |
| Positive IHC detected in | human stomach cancer tissue, mouse stomach tissue, rat stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IHC | See 1 publications below |
Product Information
30130-1-AP targets SMAD3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32595 Product name: Recombinant human SMAD3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 145-260 aa of NM_005902 Sequence: EIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGF Predict reactive species |
| Full Name | SMAD family member 3 |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 48-55 kDa |
| GenBank Accession Number | NM_005902 |
| Gene Symbol | SMAD3 |
| Gene ID (NCBI) | 4088 |
| RRID | AB_3662144 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P84022 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMAD3, also named as hMAD 3 or Mad3, is a 425 amino acid protein, which contains one MH1 domain and one MH2 domain. SMAD3 localizes in the nucleus and cytoplasm. SMAD3 plays an essential role in development and maintenance of self-tolerance and is a critical mediator of the TGFB signaling pathway. SMAD3 is involved in TGFB dependent regulation of steroidogenesis and in T-cell response to TGFB.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SMAD3 antibody 30130-1-AP | Download protocol |
| WB protocol for SMAD3 antibody 30130-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med HIC2 suppresses glioblastoma progression via transcriptional repression of SEMA3A and inhibition of TGF-β signaling | ||
Adv Sci (Weinh) A Super-Enhancer-Driven Transcriptional Regulatory Circuit Underlying Abiraterone Resistance in Castration-Resistant Prostate Cancer
| ||
J Clin Endocrinol Metab CD34+ orbital fibroblasts contribute to the pathogenesis of thyroid eye disease via miR-182-5p | ||
J Hazard Mater Decabromodiphenyl ethane induces intrauterine growth restriction by suppressing placental angiogenesis via TWIST2/NAT10-mediated ac4C-dependent TGF-β1 mRNA stabilization |









