SMAD3 Polyclonal antibody, PBS Only

• 

  WB analysis using 30130-1-AP (same clone as 30130-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30130-1-AP (SMAD3 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30130-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 30130-1-AP (same clone as 30130-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 30130-1-AP (SMAD3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30130-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 30130-1-AP (same clone as 30130-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30130-1-AP (SMAD3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30130-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 30130-1-AP (same clone as 30130-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30130-1-AP (SMAD3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30130-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat stomach using 30130-1-AP (same clone as 30130-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 30130-1-AP (SMAD3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30130-1-PBS in a different storage buffer formulation.

SMAD3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30130-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

hMAD 3, hMAD-3, hSMAD3, HSPC193, HsT17436

---

Product Information

30130-1-PBS targets SMAD3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32595

  Product name: Recombinant human SMAD3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 145-260 aa of NM_005902

  Sequence: EIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGF

• Full Name: SMAD family member 3
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48-55 kDa
• GenBank Accession Number: NM_005902
• Gene Symbol: SMAD3
• Gene ID (NCBI): 4088
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P84022
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMAD3, also named as hMAD 3 or Mad3, is a 425 amino acid protein, which contains one MH1 domain and one MH2 domain. SMAD3 localizes in the nucleus and cytoplasm. SMAD3 plays an essential role in development and maintenance of self-tolerance and is a critical mediator of the TGFB signaling pathway. SMAD3 is involved in TGFB dependent regulation of steroidogenesis and in T-cell response to TGFB.