SMAD5 Monoclonal antibody

• 

  WB analysis using 67052-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67052-1-Ig (SMAD5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 67052-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67052-1-Ig (SMAD5 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67052-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67052-1-Ig (SMAD5 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67052-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67052-1-Ig (SMAD5 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67052-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67052-1-Ig (SMAD5 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SMAD5 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67052-1-Ig

Clone No.1A6A4

Publications(6)

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat and More (1)

Applications

WB, IHC, CoIP, ELISA

Synonyms

DKFZp781C1895, DKFZp781O1323, Dwfc, hSmad5, JV5 1, MAD homolog 5, MADH5, Mothers against DPP homolog 5, SMAD 5, SMAD family member 5, SMAD5

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MCF-7 cells, HT-29 cells, Caco-2 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: human breast cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• CoIP: See 1 publications below

Product Information

67052-1-Ig targets SMAD5 in WB, IHC, CoIP, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28699

  Product name: Recombinant human SMAD5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 161-465 aa of BC009682

  Sequence: SHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS

• Full Name: SMAD family member 5
• Calculated Molecular Weight: 465 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC009682
• Gene Symbol: SMAD5
• Gene ID (NCBI): 4090
• RRID: AB_2882365
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99717
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMAD5, also named as MADH5 and JV5-1, is a transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD5 is a receptor-regulated SMAD (R-SMAD). It plays a critical role in the signaling pathway by which TGF-beta inhibits the proliferation of human hematopoietic progenitor cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Cell Physiol; HIF-1α plays an essential role in BMP9-mediated osteoblast differentiation through the induction of a glycolytic enzyme, PDK1.; Authors - Muhammad Subhan Amir
human	WB	Mol Cell Endocrinol; miR-122-5p targets GREM2 to protect against glucocorticoid-induced endothelial damage through the BMP signaling pathway.; Authors - Xianzhe Huang
mouse	WB	FEBS Lett; EGR1 plays an important role in BMP9-mediated osteoblast differentiation by promoting SMAD1/5 phosphorylation.; Authors - Norika Chiba
human	WB	Appl Bionics Biomech; Exosomes Derived from SW480-Resistant Colon Cancer Cells Are Promote Angiogenesis via BMP-2/Smad5 Signaling Pathway.; Authors - Song Yang
mouse		J Cell Biochem; TLR4/7-mediated host-defense responses of gingival epithelial cells; Authors - Norika Chiba
human,mouse	WB,CoIP	Bone; UBE2C orchestrates bone formation through stabilization of SMAD1/5; Authors - Hui Zhang