SMAD5 Monoclonal antibody, PBS Only

• 

  WB analysis using 67052-1-Ig (same clone as 67052-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67052-1-Ig (SMAD5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67052-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67052-1-Ig (same clone as 67052-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67052-1-Ig (SMAD5 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67052-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67052-1-Ig (same clone as 67052-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67052-1-Ig (SMAD5 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67052-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67052-1-Ig (same clone as 67052-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67052-1-Ig (SMAD5 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67052-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67052-1-Ig (same clone as 67052-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67052-1-Ig (SMAD5 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67052-1-PBS in a different storage buffer formulation.

SMAD5 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67052-1-PBS

Clone No.1A6A4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

DKFZp781C1895, DKFZp781O1323, Dwfc, hSmad5, JV5 1, MAD homolog 5, MADH5, Mothers against DPP homolog 5, SMAD 5, SMAD family member 5, SMAD5

---

Product Information

67052-1-PBS targets SMAD5 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28699

  Product name: Recombinant human SMAD5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 161-465 aa of BC009682

  Sequence: SHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS

• Full Name: SMAD family member 5
• Calculated Molecular Weight: 465 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC009682
• Gene Symbol: SMAD5
• Gene ID (NCBI): 4090
• RRID: AB_2882365
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99717
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMAD5, also named as MADH5 and JV5-1, is a transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD5 is a receptor-regulated SMAD (R-SMAD). It plays a critical role in the signaling pathway by which TGF-beta inhibits the proliferation of human hematopoietic progenitor cells.