Filter: AllWBIHC

WB analysis of HeLa using 16397-1-AP (same clone as 16397-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
WB analysis of mouse lung using 16397-1-AP (same clone as 16397-1-PBS)
mouse lung tissue were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
WB analysis of A549 using 16397-1-AP (same clone as 16397-1-PBS)
A549 cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 16397-1-AP (same clone as 16397-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 16397-1-AP (same clone as 16397-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 16397-1-AP (same clone as 16397-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
WB analysis of A549 using 16397-1-AP (same clone as 16397-1-PBS)
A549 cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
WB analysis of mouse lung using 16397-1-AP (same clone as 16397-1-PBS)
mouse lung tissue were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 16397-1-AP (same clone as 16397-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 16397-1-AP (SMAD9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 16397-1-AP (same clone as 16397-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16397-1-AP (SMAD9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
IHC staining of rat heart using 16397-1-AP (same clone as 16397-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 16397-1-AP (SMAD9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 16397-1-AP (same clone as 16397-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 16397-1-AP (SMAD9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.
IHC staining of human urothelial carcinoma using 16397-1-AP (same clone as 16397-1-PBS)
Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 16397-1-AP (SMAD9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16397-1-PBS in a different storage buffer formulation.

SMAD9 Polyclonal antibody, PBS Only

SMAD9 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16397-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

MAD homolog 9, MADH6, MADH9, Mothers against DPP homolog 9, SMAD 9

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

16397-1-PBS targets SMAD9 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9490 Product name: Recombinant human SMAD9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-352 aa of BC011559 Sequence: MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQL Predict reactive species
Full Name	SMAD family member 9
Calculated Molecular Weight	430 aa, 49 kDa
Observed Molecular Weight	49-55 kDa
GenBank Accession Number	BC011559
Gene Symbol	SMAD9
Gene ID (NCBI)	4093
RRID	AB_2270847
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O15198
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

SMAD9 (also known as MADH9 or MAD homolog 9) is a key signaling molecule in the transforming growth factor-β (TGF-β) superfamily signaling pathway and belongs to the SMAD1/5/9 subgroup of receptor-regulated SMADs (R-SMADs). It is primarily activated and phosphorylated by BMP (bone morphogenetic protein) type I receptors. Once activated, SMAD9 forms a complex with the common SMAD4 (Co-SMAD), translocates into the nucleus, and acts as a transcription factor to regulate the expression of specific target genes. This process is involved in modulating a variety of critical biological processes, including cell proliferation, differentiation, apoptosis, and embryonic development. Mutations or abnormal expression of SMAD9 are associated with several diseases, particularly in pulmonary arterial hypertension, certain cancers, and vascular diseases, where it plays a significant role.