SMAD9 Polyclonal antibody

• 

  WB analysis of HeLa using 16397-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 16397-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 16397-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16397-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 16397-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 16397-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 16397-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 16397-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16397-1-AP (SMAD9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

SMAD9 Polyclonal Antibody for WB, ELISA

Cat No. 16397-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

MAD homolog 9, MADH6, MADH9, Mothers against DPP homolog 9, SMAD 9

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells, HepG2 cells, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

16397-1-AP targets SMAD9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9490

  Product name: Recombinant human SMAD9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-352 aa of BC011559

  Sequence: MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQL

• Full Name: SMAD family member 9
• Calculated Molecular Weight: 430 aa, 49 kDa
• Observed Molecular Weight: 49-55 kDa
• GenBank Accession Number: BC011559
• Gene Symbol: SMAD9
• Gene ID (NCBI): 4093
• RRID: AB_2270847
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15198
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMAD9 (also known as MADH9 or MAD homolog 9) is a key signaling molecule in the transforming growth factor-β (TGF-β) superfamily signaling pathway and belongs to the SMAD1/5/9 subgroup of receptor-regulated SMADs (R-SMADs). It is primarily activated and phosphorylated by BMP (bone morphogenetic protein) type I receptors. Once activated, SMAD9 forms a complex with the common SMAD4 (Co-SMAD), translocates into the nucleus, and acts as a transcription factor to regulate the expression of specific target genes. This process is involved in modulating a variety of critical biological processes, including cell proliferation, differentiation, apoptosis, and embryonic development. Mutations or abnormal expression of SMAD9 are associated with several diseases, particularly in pulmonary arterial hypertension, certain cancers, and vascular diseases, where it plays a significant role.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	IUBMB Life; LncRNA RP11-301G19.1 is required for the maintenance of vascular smooth muscle cell contractile phenotype via sponging miR-17-5P/ATOH8 axis; Authors - Shuning Hao
mouse	WB	Sci Rep; Schisandrin B regulates MC3T3-E1 subclone 14 cells proliferation and differentiation through BMP2-SMADs-RUNX2-SP7 signaling axis.; Authors - Xueni Wang
mouse	WB	Cell Death Discov; Gsα deficiency facilitates cardiac remodeling via CREB/ Bmp10-mediated signaling; Authors - Ping Yin
	WB	Bioact Mater; A tantalum-containing zirconium-based metallic glass with superior endosseous implant relevant properties; Authors - Yunshu Wu