SMAGP Polyclonal antibody

• 

  WB analysis using 30910-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30910-1-AP (LOC57228 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 30910-1-AP

  WB result of SMAGP antibody (30910-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-SMAGP transfected HeLa cells.

• 

  IF Staining of HeLa using 30910-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using LOC57228 antibody (30910-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• Featured Product
• KD/KO Validated

SMAGP Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30910-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

LOC57228

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse colon tissue, mouse lung tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30910-1-AP targets SMAGP in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34278

  Product name: Recombinant human LOC57228 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-97 aa of BC120965

  Sequence: VVFLTLLSVVILIFFYLYKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI

• Full Name: small trans-membrane and glycosylated protein
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC120965
• Gene Symbol: SMAGP
• Gene ID (NCBI): 57228
• RRID: AB_3669781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q0VAQ4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Small transmembrane and glycosylated protein (SMAGP) consists of 97 amino acids and contains a transmembrane domain. SMAGP localizes to the lateral face of the plasma membrane and is expressed in the cytoplasm after cell transformation. (PMID: 30410350)