• Featured Product
  • KD/KO Validated

SMARCA4/BRG1 Polyclonal antibody

SMARCA4/BRG1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 21634-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA

ATP dependent helicase SMARCA4, BAF190, BAF190A, BRG1, BRG1 associated factor 190A, hSNF2b, Protein brahma homolog 1, Protein BRG 1, SMARCA4, SMARCA4/BRG1, SNF2, SNF2 BETA, SNF2B, SNF2L4, SNF2LB, SWI2, Transcription activator BRG1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, human placenta tissue, mouse brain tissue, rat brain tissue, MCF-7 cells, PC-3 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman colon cancer tissue, human lung cancer tissue, mouse kidney tissue, human breast cancer tissue, human gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells, HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21634-1-AP targets SMARCA4/BRG1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, zebrafish, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16256

Product name: Recombinant human SMARCA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 207-298 aa of BC150298

Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST

Predict reactive species
Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Calculated Molecular Weight 1647 aa, 185 kDa
Observed Molecular Weight 185 kDa
GenBank Accession NumberBC150298
Gene Symbol SMARCA4
Gene ID (NCBI) 6597
RRIDAB_10858784
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP51532
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.

Protocols

Product Specific Protocols
IF protocol for SMARCA4/BRG1 antibody 21634-1-APDownload protocol
IHC protocol for SMARCA4/BRG1 antibody 21634-1-APDownload protocol
IP protocol for SMARCA4/BRG1 antibody 21634-1-APDownload protocol
WB protocol for SMARCA4/BRG1 antibody 21634-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

J Clin Oncol

Genomic Characterization of Non-Small-Cell Lung Cancer in African Americans by Targeted Massively Parallel Sequencing.

Authors - Luiz H Araujo
humanWB

Cell Stem Cell

The long noncoding RNA lncTCF7 promotes self-renewal of human liver cancer stem cells through activation of Wnt signaling.

Authors - Yanying Wang
ChIP

Mol Cell

SPT5 stabilizes RNA polymerase II, orchestrates transcription cycles, and maintains the enhancer landscape.

Authors - Shibin Hu
humanWB,IP

Nucleic Acids Res

Reactivation of the G1 enhancer landscape underlies core circuitry addiction to SWI/SNF

Authors - Katerina Cermakova
humanIHC

Sci Adv

Organoid drug profiling identifies methotrexate as a therapy for SCCOHT, a rare pediatric cancer

Authors - Seok-Young Kim
humanWB,IHC

Nat Commun

LncBRM initiates YAP1 signalling activation to drive self-renewal of liver cancer stem cells.

Authors - Pingping Zhu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tatyana (Verified Customer) (06-15-2025)

Incubation for 2 h at RT, in 5% goat serum/PBST. Gives very good nuclear signal.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa/human
SMARCA4/BRG1 Antibody Immunofluorescence validation (1:1000 dilution) in HeLa/human (Cat no:21634-1-AP)
FH

Satyendra (Verified Customer) (07-16-2021)

I have marked Knock out as KO

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK 293
SMARCA4/BRG1 Antibody Western Blot validation (1:1000 dilution) in HEK 293 (Cat no:21634-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...