Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, human placenta tissue, mouse brain tissue, rat brain tissue, MCF-7 cells, PC-3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon cancer tissue, human lung cancer tissue, mouse kidney tissue, human breast cancer tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells, HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21634-1-AP targets SMARCA4/BRG1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16256 Product name: Recombinant human SMARCA4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-298 aa of BC150298 Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST Predict reactive species |
| Full Name | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 |
| Calculated Molecular Weight | 1647 aa, 185 kDa |
| Observed Molecular Weight | 185 kDa |
| GenBank Accession Number | BC150298 |
| Gene Symbol | SMARCA4 |
| Gene ID (NCBI) | 6597 |
| RRID | AB_10858784 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51532 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SMARCA4/BRG1 antibody 21634-1-AP | Download protocol |
| IHC protocol for SMARCA4/BRG1 antibody 21634-1-AP | Download protocol |
| IP protocol for SMARCA4/BRG1 antibody 21634-1-AP | Download protocol |
| WB protocol for SMARCA4/BRG1 antibody 21634-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
SMARCA4/BRG1 Polyclonal antibody (Cat# 21634-1-AP) has 56 citations published in journals including Nature Communications, Molecular Cell, Nucleic Acids Research, Cell Reports, Cancer Research, Cell Stem Cell, Development, and PLoS Genetics. Associated research fields encompass cancer (liver, lung, colorectal, ovarian, glioma), chromatin remodeling, stem cell biology, development, neurology, cardiovascular disease, and epigenetics.
| Species | Application | Title |
|---|---|---|
J Clin Oncol Genomic Characterization of Non-Small-Cell Lung Cancer in African Americans by Targeted Massively Parallel Sequencing. | ||
Cell Stem Cell The long noncoding RNA lncTCF7 promotes self-renewal of human liver cancer stem cells through activation of Wnt signaling. | ||
Cancer Res SWI/SNF Blockade Disrupts PU.1-Directed Enhancer Programs in Normal Hematopoietic Cells and Acute Myeloid Leukemia | ||
Nat Commun ACTL6A protects gastric cancer cells against ferroptosis through induction of glutathione synthesis | ||
Nat Commun TGFβ-activated PDHB promotes mitochondrial pyruvate metabolism and contributes to human endoderm differentiation via ATP-dependent BRG1. | ||
Nat Commun PCGF1-PRC1 links chromatin repression with DNA replication during hematopoietic cell lineage commitment |
Reviews
What customers say
Both reviewers gave this antibody a perfect 5-star rating. One user performed immunofluorescence on HeLa cells at 1:1000 dilution (2 h at RT in 5% goat serum/PBST) and reported very good nuclear signal. The other used it for Western Blot on HEK 293 cells at the same 1:1000 dilution and confirmed specificity through a knockout validation. Overall, users find this antibody reliable and specific for both IF and WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tatyana (Verified Customer) (06-15-2025) | Incubation for 2 h at RT, in 5% goat serum/PBST. Gives very good nuclear signal.
 |
Satyendra (Verified Customer) (07-16-2021) | I have marked Knock out as KO
 |
