SMARCA4/BRG1 Recombinant monoclonal antibody

• 

  WB analysis using 83310-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83310-2-RR (SMARCA4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse colon using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with .

• 

  IHC staining of mouse colon using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with .

• 

  IHC staining of human placenta using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat cerebellum using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat cerebellum using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat colon using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat colon using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat lung using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat lung using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 83310-2-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 83310-2-RR (SMARCA4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 83310-2-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SMARCA4 antibody (83310-2-RR, Clone: 240172F4 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of Jurkat using 83310-2-RR

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug SMARCA4 Recombinant antibody (83310-2-RR, Clone:240172F4) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• 

  Affinity and Kinetic Characterization of 83310-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83310-2-RR against Human SMARCA4 were performed. The affinity constant is 3.66 nM.

SMARCA4/BRG1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 83310-2-RR

Clone No.240172F4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

SMARCA4, 240172F4, ATP dependent helicase SMARCA4, ATP-dependent helicase SMARCA4, BAF190

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells, HEK-293T cells, C6 cells
• Positive IHC detected in: human tonsillitis tissue, human placenta tissue, mouse cerebellum tissue, mouse colon tissue, mouse lung tissue, rat cerebellum tissue, rat colon tissue, rat lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83310-2-RR targets SMARCA4/BRG1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16256

  Product name: Recombinant human SMARCA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 207-298 aa of BC150298

  Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST

• Full Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
• Calculated Molecular Weight: 1647 aa, 185 kDa
• Observed Molecular Weight: 185 kDa
• GenBank Accession Number: BC150298
• Gene Symbol: SMARCA4
• Gene ID (NCBI): 6597
• RRID: AB_3670976
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51532
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.