Product Information
21634-1-PBS targets SMARCA4/BRG1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16256 Product name: Recombinant human SMARCA4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-298 aa of BC150298 Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST Predict reactive species |
Full Name | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 |
Calculated Molecular Weight | 1647 aa, 185 kDa |
Observed Molecular Weight | 185 kDa |
GenBank Accession Number | BC150298 |
Gene Symbol | SMARCA4 |
Gene ID (NCBI) | 6597 |
RRID | AB_10858784 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P51532 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.