SMARCB1 Monoclonal antibody

• 

  WB analysis using 67979-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67979-1-Ig (SMARCB1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse stomach using 67979-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 67979-1-Ig (SMARCB1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse stomach using 67979-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 67979-1-Ig (SMARCB1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SMARCB1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67979-1-Ig

Clone No.1D10A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

1D10A4, BAF47, BRG1-associated factor 47, hSNF5, hSNFS

---

Tested Applications

• Positive WB detected in: NCCIT cells, LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67979-1-Ig targets SMARCB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28911

  Product name: Recombinant human SMARCB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of NM_003073

  Sequence: MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTF

• Full Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: NM_003073
• Gene Symbol: SMARCB1
• Gene ID (NCBI): 6598
• RRID: AB_2918728
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q12824
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMARCB1 is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene.