Tested Applications
| Positive FC (Intra) detected in | HeLa cells |
| Positive FC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Flow Cytometry (FC) | FC : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-67979 targets SMARCB1 in FC (Intra) applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28911 Product name: Recombinant human SMARCB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-164 aa of NM_003073 Sequence: MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTF Predict reactive species |
| Full Name | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 |
| Calculated Molecular Weight | 44 kDa |
| Observed Molecular Weight | 40-45 kDa |
| GenBank Accession Number | NM_003073 |
| Gene Symbol | SMARCB1 |
| Gene ID (NCBI) | 6598 |
| RRID | AB_2923846 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q12824 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SMARCB1 is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 SMARCB1 antibody CL488-67979 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

