CoraLite® Plus 488-conjugated SMARCB1 Monoclonal antibody

SMARCB1 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67979
Clone No.1D10A4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

FC (Intra)

SMARCB1, SNF5, SNF5L1, Snr1, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1, 1D10A4, BAF47, BRG1-associated factor 47, hSNF5, hSNFS, INI1, INI-1, RDT, Sfh1p

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67979 targets SMARCB1 in FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28911

Product name: Recombinant human SMARCB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-164 aa of NM_003073

Sequence: MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTF

Predict reactive species
Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Calculated Molecular Weight 44 kDa
Observed Molecular Weight40-45 kDa
GenBank Accession NumberNM_003073
Gene Symbol SMARCB1
Gene ID (NCBI) 6598
RRIDAB_2923846
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ12824
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SMARCB1 is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SMARCB1 antibody CL488-67979Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...