SMARCB1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67979-1-Ig (same clone as 67979-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67979-1-Ig (SMARCB1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67979-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 67979-1-Ig (same clone as 67979-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 67979-1-Ig (SMARCB1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67979-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 67979-1-Ig (same clone as 67979-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 67979-1-Ig (SMARCB1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67979-1-PBS in a different storage buffer formulation.

SMARCB1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67979-1-PBS

Clone No.1D10A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

1D10A4, BAF47, BRG1-associated factor 47, hSNF5, hSNFS

---

Product Information

67979-1-PBS targets SMARCB1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28911

  Product name: Recombinant human SMARCB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of NM_003073

  Sequence: MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTF

• Full Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: NM_003073
• Gene Symbol: SMARCB1
• Gene ID (NCBI): 6598
• RRID: AB_2918728
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q12824
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMARCB1 is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene.