Filter: AllWBIHC

WB analysis of RAW264.7 using 11156-1-AP
RAW264.7 cells were subjected to SDS PAGE followed by western blot with 11156-1-AP (SMARCD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse thymus using 11156-1-AP
mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11156-1-AP (SMARCD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
IHC staining of human cervical cancer using 11156-1-AP
Immunohistochemical analysis of paraffin-embedded human cervical cancer using 11156-1-AP (SMARCD2 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of mouse spleen using 11156-1-AP
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11156-1-AP (SMARCD2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse spleen using 11156-1-AP
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11156-1-AP (SMARCD2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat spleen using 11156-1-AP
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 11156-1-AP (SMARCD2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat spleen using 11156-1-AP
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 11156-1-AP (SMARCD2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SMARCD2 Polyclonal antibody

SMARCD2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11156-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2, SMARCD 2, CRACD2, BRG1-associated factor 60B, 60 kDa BRG-1/Brm-associated factor subunit B

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	RAW 264.7 cells, RAW264.7 cells
Positive IHC detected in	mouse spleen tissue, human cervical cancer tissue, rat spleen tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11156-1-AP targets SMARCD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1630 Product name: Recombinant human SMARCD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC018953 Sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT Predict reactive species
Full Name	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Calculated Molecular Weight	52 kDa
Observed Molecular Weight	52 kDa
GenBank Accession Number	BC018953
Gene Symbol	SMARCD2
Gene ID (NCBI)	6603
RRID	AB_2192145
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q92925
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The SWI/SNF chromatin remodelling complexes are important regulators of transcription; they consist of large multisubunit assemblies containing either Brm or Brg1 as the catalytic ATPase subunit and a variable subset of approximately 10 Brg/Brm-associated factors (BAF) [PMID:20148946]. SMARCD2 is one of BAF60 proteins, which are found in most complexes, is thought to bridge interactions between transcription factors and SWI/SNF complexes. [PMID:9427560]