Tested Applications
Positive WB detected in | RAW 264.7 cells, RAW264.7 cells |
Positive IHC detected in | mouse spleen tissue, human cervical cancer tissue, rat spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
11156-1-AP targets SMARCD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1630 Product name: Recombinant human SMARCD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC018953 Sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT Predict reactive species |
Full Name | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 |
Calculated Molecular Weight | 52 kDa |
Observed Molecular Weight | 52 kDa |
GenBank Accession Number | BC018953 |
Gene Symbol | SMARCD2 |
Gene ID (NCBI) | 6603 |
RRID | AB_2192145 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q92925 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The SWI/SNF chromatin remodelling complexes are important regulators of transcription; they consist of large multisubunit assemblies containing either Brm or Brg1 as the catalytic ATPase subunit and a variable subset of approximately 10 Brg/Brm-associated factors (BAF) [PMID:20148946]. SMARCD2 is one of BAF60 proteins, which are found in most complexes, is thought to bridge interactions between transcription factors and SWI/SNF complexes. [PMID:9427560]
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SMARCD2 antibody 11156-1-AP | Download protocol |
IHC protocol for SMARCD2 antibody 11156-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |