Tested Applications
Positive WB detected in | HEK-293 cells |
Positive IHC detected in | human colon cancer tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25815-1-AP targets SMCO4 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22806 Product name: Recombinant human C11orf75 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-59 aa of BC031564 Sequence: MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE Predict reactive species |
Full Name | chromosome 11 open reading frame 75 |
Calculated Molecular Weight | 59 aa, 7 kDa |
Observed Molecular Weight | 7 kDa |
GenBank Accession Number | BC031564 |
Gene Symbol | SMCO4 |
Gene ID (NCBI) | 56935 |
RRID | AB_2880249 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NRQ5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMCO4, also named as C11orf75 and FN5, is a Single-pass membrane and coiled-coil domain-containing protein.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SMCO4 antibody 25815-1-AP | Download protocol |
IHC protocol for SMCO4 antibody 25815-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |