Tested Applications
| Positive WB detected in | human testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13936-1-AP targets SMCP in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4984 Product name: Recombinant human SMCP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC014593 Sequence: MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK Predict reactive species |
| Full Name | sperm mitochondria-associated cysteine-rich protein |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 12-25 kDa |
| GenBank Accession Number | BC014593 |
| Gene Symbol | SMCP |
| Gene ID (NCBI) | 4184 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49901 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMCP, also named as MCS and MCSP, is a cysteine- and proline-rich structural protein that is closely associated with the keratinous capsules of sperm mitochondria in the mitochondrial sheath surrounding the outer dense fibers and axoneme. It is involved in sperm motility.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SMCP antibody 13936-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

