Tested Applications
| Positive WB detected in | K-562 cells, HepG2 cells, HEK-293 cells, Jurkat cells | 
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
| IF | See 1 publications below | 
Product Information
22329-1-AP targets SMN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag17798 Product name: Recombinant human SMN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-168 aa of BC000908 Sequence: VLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTD Predict reactive species | 
                                    
| Full Name | survival of motor neuron 2, centromeric | 
| Calculated Molecular Weight | 282 aa, 30 kDa | 
| Observed Molecular Weight | 38 kDa | 
| GenBank Accession Number | BC000908 | 
| Gene Symbol | SMN | 
| Gene ID (NCBI) | 6607 | 
| RRID | AB_2879074 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen Affinity purified | 
| UNIPROT ID | Q16637 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Spinal muscular atrophy (SMA) is an autosomal recessive neurodegenerative disease characterized by loss of anterior horn cells in the spinal cord and concomitant symmetrical muscle weakness and atrophy (PMID: 16364894 ). SMA is caused by deletion or mutations of the survival motor neuron (SMN1) gene. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional (PMID: 17355180). A large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein (PMID: 10369862). The level of SMN protein correlates with phenotypic severity of SMA.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SMN antibody 22329-1-AP | Download protocol | 
| IHC protocol for SMN antibody 22329-1-AP | Download protocol | 
| WB protocol for SMN antibody 22329-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 















