SMNDC1 Monoclonal antibody

• 

  WB analysis using 68344-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68344-1-Ig (SMNDC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control.

• 

  FC experiment of HeLa using 68344-1-Ig

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug SMNDC1 Monoclonal antibody (68344-1-Ig, Clone: 1B10C2) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1) (red), or 0.8 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set.

SMNDC1 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 68344-1-Ig

Clone No.1B10C2

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

Survival motor neuron domain-containing protein 1, SPF30, SMN-related protein, SMNR, SMN related protein

---

Tested Applications

• Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, Daudi cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

68344-1-Ig targets SMNDC1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33140

  Product name: Recombinant human SMNDC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-238 aa of BC011234

  Sequence: MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ

• Full Name: survival motor neuron domain containing 1
• Calculated Molecular Weight: 238 aa, 27 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC011234
• Gene Symbol: SMNDC1
• Gene ID (NCBI): 10285
• RRID: AB_3085068
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75940
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Survival motor neuron domain-containing protein 1 (SMNDC1), also known as survival of motor neuron-related-splicing factor 30 (SPF30) or SMN-related protein (SMNR), is a constituent of the spliceosome complex that plays an essential role in spliceosome assembly by recruiting U4/U5/U6 tri-snRNP to the pre-spliceosomal complex (PMID: 9817934; 11331595; 30904945). Both SMNDC1 and SMN1 contain a highly conserved central Tudor domain which functions as a protein-protein interaction surface and mediates binding to the spliceosomal Sm proteins (PMID: 11331595).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cancer; Two isoleucyl tRNAs that decode synonymous codons divergently regulate breast cancer metastatic growth by controlling translation of proliferation-regulating genes; Authors - Lisa B Earnest-Noble