SMPD3 Polyclonal antibody

• 

  WB analysis using 25613-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25613-1-AP (SMPD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25613-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 25613-1-AP (SMPD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SMPD3 Polyclonal Antibody for WB, ELISA

Cat No. 25613-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

EC:3.1.4.12, Neutral sphingomyelinase 2, Neutral sphingomyelinase II, nSMase 2, nSMase2

---

Tested Applications

• Positive WB detected in: A549 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

25613-1-AP targets SMPD3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22487

  Product name: Recombinant human SMPD3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 540-655 aa of BC112238

  Sequence: PGEEKPWAIGTLLDTNGLYDEDVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLKGNGRRIDYMLHAEEGLCPDWKAEVEEFSFITQLSGLTDHLPVAMRLMVSSGEEEA

• Full Name: sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II)
• Calculated Molecular Weight: 655 aa, 71 kDa
• Observed Molecular Weight: 70-71 kDa
• GenBank Accession Number: BC112238
• Gene Symbol: SMPD3
• Gene ID (NCBI): 55512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NY59
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMPD3 (sphingomyelin phosphodiesterase 3), also called neutral sphingomyelinase-2 (nSMase2), is a Golgi-enriched, membrane-bound Zn²⁺-dependent hydrolase that converts sphingomyelin into ceramide and phosphocholine. Ceramide functions as a bioactive lipid second messenger that integrates cellular stress, apoptosis, autophagy and differentiation signals.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Endocrinol; ChREBP-β regulates thermogenesis in brown adipose tissue.; Authors - Chunchun Wei