Product Information
68801-2-PBS targets SMPD3 as part of a matched antibody pair:
MP50168-1: 68801-1-PBS capture and 68801-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22487 Product name: Recombinant human SMPD3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 540-655 aa of BC112238 Sequence: PGEEKPWAIGTLLDTNGLYDEDVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLKGNGRRIDYMLHAEEGLCPDWKAEVEEFSFITQLSGLTDHLPVAMRLMVSSGEEEA Predict reactive species |
| Full Name | sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II) |
| Calculated Molecular Weight | 655 aa, 71 kDa |
| GenBank Accession Number | BC112238 |
| Gene Symbol | SMPD3 |
| Gene ID (NCBI) | 55512 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A Magarose purification |
| UNIPROT ID | Q9NY59 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



