SMR3B Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of human saliva using 85745-3-RR (same clone as 85745-3-PBS)

  human saliva were subjected to SDS PAGE followed by western blot with 85745-3-RR (SMR3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85745-3-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02114-1

  The mean SMR3B concentration was determined to be 8.50 ng/mL in HeLa cell extract based on a 1.30 mg/mL extract load, 8.00 ng/mL in HepG2 cell extract based on a 0.90 mg/mL extract load, 12.70 ng/mL in A549 cell extract based on a 2.40 mg/mL extract load and 9.20 ng/mL in MCF-7 cell extract based on a 1.20 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02114-1

  Sandwich ELISA standard curve of MP02114-1, Human SMR3B Recombinant Matched Antibody Pair - PBS only. 85745-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg3081. 85745-2-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

• 

  Cytometric bead array standard curve of MP02114-1

  Cytometric bead array standard curve of MP02114-1, SMR3B Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85745-3-PBS. Detection antibody: 85745-2-PBS. Standard: Eg3081. Range: 0.313-40 ng/mL.

• 

  Affinity of 85745-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85745-3-RR against Human SMR3B were performed. The affinity constant is 0.785 nM.

SMR3B Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 85745-3-PBS

Clone No.242868D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

P B, PBII, PRL3, PROL3, Proline rich peptide P B

---

Product Information

85745-3-PBS targets SMR3B as part of a matched antibody pair:

MP02114-1: 85745-3-PBS capture and 85745-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3081

  Product name: Recombinant Human SMR3B protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 23-79 aa of NM_006685.4

  Sequence: QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP

• Full Name: submaxillary gland androgen regulated protein 3B
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: NM_006685.4
• Gene Symbol: SMR3B
• Gene ID (NCBI): 10879
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02814
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMR3B is an androgen-regulated secreted PRP-family peptide produced primarily in the submandibular and sublingual glands. Released into saliva, it contributes to lubrication, oral defense, and glandular homeostasis. Highly tissue-specific, SMR3B serves as a marker of salivary gland function and is altered in xerostomia, Sjögren's syndrome, and head-and-neck cancers, highlighting its relevance in secretory physiology and disease.