Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SNAI1 Polyclonal antibody

SNAI1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13099-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF, IP, CoIP, ChIP, RIP, ELISA

SLUGH 2, SLUGH2, SNAI 1, SNAIL1, Zinc finger protein SNAI1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, PC-3 cells, BxPC-3 cells, human heart tissue, COLO 320 cells, MCF-7 cells
Positive IP detected inMCF-7 cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13099-1-AP targets SNAI1 in WB, IHC, IF, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3723

Product name: Recombinant human SNAI1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-264 aa of BC012910

Sequence: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR

Predict reactive species
Full Name snail homolog 1 (Drosophila)
Calculated Molecular Weight 264 aa, 29 kDa
Observed Molecular Weight29-35 kDa
GenBank Accession NumberBC012910
Gene Symbol SNAI1
Gene ID (NCBI) 6615
RRIDAB_2191756
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95863
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNAI1, a member of SNAI1 family of protein, participates in the epithelial to mesenchymal transition(EMT) and formation and maintenance of embryonic mesoderm. The snail family share a common structural, that a highly conserved C-terminal region containing a zinc finger transcription factor. SNAI1 interacts with other corepressor, such as Ajuba, PRMT5 and SIN3a or HDAC1 and 2, to repress the target gene. As the phosphorylation modification of SNAI1 protein, the range of molecular weight of SNAI1 is about 25-30 kDa (PMID: 22276203 ). Once phosphorylated (probably on Ser-107, Ser-111, Ser-115 and Ser-119) it is exported from the nucleus to the cytoplasm where subsequent phosphorylation of the destruction motif and ubiquitination involving BTRC occurs.

Protocols

Product Specific Protocols
IHC protocol for SNAI1 antibody 13099-1-APDownload protocol
IP protocol for SNAI1 antibody 13099-1-APDownload protocol
WB protocol for SNAI1 antibody 13099-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
rat,humanWB

Signal Transduct Target Ther

Prostaglandin E2-driven dedifferentiation of Schwann cells leads to perineural invasion in pancreatic ductal adenocarcinoma

Authors - Ling Wang
mouseIHC

Nature

Divergent transcriptional regulation of astrocyte reactivity across disorders.

Authors - Joshua E Burda
mouseWB

Nat Med

Translation control of the immune checkpoint in cancer and its therapeutic targeting.

Authors - Yichen Xu
humanWB

Mol Cancer

LINC00922 decoys SIRT3 to facilitate the metastasis of colorectal cancer through up-regulation the H3K27 crotonylation of ETS1 promoter

Authors - Meijian Liao
humanWB

Mol Cancer

OLFM4 promotes the progression of intestinal metaplasia through activation of the MYH9/GSK3β/β-catenin pathway

Authors - Hongfa Wei
humanWB

Mol Cancer

The long non-coding RNA PTTG3P promotes cell growth and metastasis via up-regulating PTTG1 and activating PI3K/AKT signaling in hepatocellular carcinoma.

Authors - Jin-Lan Huang

Reviews

    4.2 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Angie (Verified Customer) (07-26-2025)

Used at 1:500 dilution and incubated overnight at 4°C. Secondary antibody: Donkey-anti-rabbit (Alexa Fluor 680) at 1:20000 dilution incubated at room temperature for 1 hour.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: A549
SNAI1 Antibody Western Blot validation (1:500 dilution) in A549 (Cat no:13099-1-AP)

Gisella (Verified Customer) (07-10-2025)

Antibody worked well in canine bladder tissue IHC (FFPE) at dilution of 1:100. Developed almost immediately, so probably could have tried higher dilution.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Canine bladder tissue

Udesh (Verified Customer) (08-16-2023)

Worked well in WB at 1:2000

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Glioblastoma cells

Hala (Verified Customer) (11-23-2021)

works very good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HepG2
Loading...
||
New chat

Able

正在加载,请稍候...