SNAT2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83968-5-RR (same clone as 83968-5-PBS)

  Boiled and unboiled mouse brain tissues were subjected to SDS PAGE followed by western blot with 83968-5-RR (SLC38A2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83968-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 83968-5-RR (same clone as 83968-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 83968-5-RR (SNAT2 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83968-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83968-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83968-5-RR against Human SNAT2 were performed. The affinity constant is below 1 pM.

SNAT2 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 83968-5-PBS

Clone No.241059C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

SLC38A2, 241059C6, ATA2, KIAA1382, PRO1068

---

Product Information

83968-5-PBS targets SNAT2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23082

  Product name: Recombinant human SLC38A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-50 aa of BC040342

  Sequence: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQN

• Full Name: solute carrier family 38, member 2
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC040342
• Gene Symbol: SLC38A2
• Gene ID (NCBI): 54407
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q96QD8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SNAT2 (Sodium-dependent neutral amino acid transporter-2), the ubiquitous member of SLC38 family, accounts for the activity of transport system A for neutral amino acids in most mammalian tissues (PMID: 16734764). SNAT2 mediates uptake of neutral α-amino acids and are expressed in central neurons (PMID: 19240036). SNAT2 is expressed in breast cancer cell lines. SLC38A2 also acts as a selective target for inhibiting growth of Gln-dependent breast cancer cell lines (PMID: 33028955).