Tested Applications
Positive IHC detected in | mouse brain tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | U2OS cells |
The antibody is only suitable for IF and IHC detection.
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
13914-1-AP targets SNN in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4909 Product name: Recombinant human SNN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC036443 Sequence: MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEVHG Predict reactive species |
Full Name | stannin |
Calculated Molecular Weight | 9 kDa |
GenBank Accession Number | BC036443 |
Gene Symbol | SNN |
Gene ID (NCBI) | 8303 |
RRID | AB_2918033 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75324 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Stannin (Snn) is discovered using subtractive hybridization methodology designed to find gene products related to selective organotin toxicity and apoptosis. It is present in TMT-sensitive cells and may play a role in the selective toxicity of organotin compounds.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for SNN antibody 13914-1-AP | Download protocol |
IF protocol for SNN antibody 13914-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |