Tested Applications
Positive WB detected in | HEK-293 cells, HL-60 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
IHC | See 1 publications below |
Product Information
10352-1-AP targets SNRPD1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0364 Product name: Recombinant human SNRPD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC001721 Sequence: MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR Predict reactive species |
Full Name | small nuclear ribonucleoprotein D1 polypeptide 16kDa |
Calculated Molecular Weight | 16 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC001721 |
Gene Symbol | SNRPD1 |
Gene ID (NCBI) | 6632 |
RRID | AB_2193875 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P62314 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Systemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD1 is one Sm components of the small nuclear ribonucleoprotein complexes(snRNPs). It's a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA. This antibody detectes 13-16 kDa (SMD1) and 30 kDa (SMD1/SMD2 dimer form; PMID:15525645).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SNRPD1 antibody 10352-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Chem Biol Novel RNA-Affinity Proteogenomics Dissects Tumor Heterogeneity for Revealing Personalized Markers in Precision Prognosis of Cancer. | ||
Pharmacol Res Second-generation antipsychotics induce cardiotoxicity by disrupting spliceosome signaling: Implications from proteomic and transcriptomic analyses. | ||
Neuron Inhibition of RNA splicing triggers CHMP7 nuclear entry, impacting TDP-43 function and leading to the onset of ALS cellular phenotypes | ||
EPMA J Deciphering key roles of B cells in prognostication and tailored therapeutic strategies for lung adenocarcinoma: a multi-omics and machine learning approach towards predictive, preventive, and personalized treatment strategies |