SNRPD2 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66111-1-Ig (same clone as 66111-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66111-1-Ig (SNRPD2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66111-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66111-1-Ig (same clone as 66111-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 66111-1-Ig (SNRPD2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66111-1-PBS in a different storage buffer formulation.

SNRPD2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66111-1-PBS

Clone No.1F12B2

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Sm D2, SMD2, snRNP core protein D2, SNRPD2

---

Product Information

66111-1-PBS targets SNRPD2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7115

  Product name: Recombinant human SNRPD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-118 aa of BC000486

  Sequence: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

• Full Name: small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14-16 kDa
• GenBank Accession Number: BC000486
• Gene Symbol: SNRPD2
• Gene ID (NCBI): 6633
• RRID: AB_2881510
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P62316
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Systemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD2 is one of Sm protein, and is required for pre-mRNA splicing, snRNP biogenesis.