Product Information
66111-1-PBS targets SNRPD2 in WB, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7115 Product name: Recombinant human SNRPD2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-118 aa of BC000486 Sequence: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK Predict reactive species |
Full Name | small nuclear ribonucleoprotein D2 polypeptide 16.5kDa |
Calculated Molecular Weight | 14 kDa |
Observed Molecular Weight | 14-16 kDa |
GenBank Accession Number | BC000486 |
Gene Symbol | SNRPD2 |
Gene ID (NCBI) | 6633 |
RRID | AB_2881510 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P62316 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Systemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD2 is one of Sm protein, and is required for pre-mRNA splicing, snRNP biogenesis.