SNRPD3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SNRPD3 Polyclonal antibody (10379-1-AP)

SNRPD3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10379-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Sm D3, SMD3, snRNP core protein D3, SNRPD3

• 

  WB analysis of MCF-7 using 10379-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 10379-1-AP (SNRPD3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 10379-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 10379-1-AP (SNRPD3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 10379-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 10379-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10379-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10379-1-AP (SNRPD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10379-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10379-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10379-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10379-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10379-1-AP (SNRPD3 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SNRPD3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF7 cells, MCF-7 cells
• Positive IHC detected in: human small intestine tissue, human breast cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10379-1-AP targets SNRPD3 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0293

  Product name: Recombinant human SNRPD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-119 aa of BC000457

  Sequence: EGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRG

• Full Name: small nuclear ribonucleoprotein D3 polypeptide 18kDa
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC000457
• Gene Symbol: SNRPD3
• Gene ID (NCBI): 6634
• RRID: AB_2286308
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62318
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Small nuclear ribonucleoprotein D3 polypeptide 18kDa (SNRPD3,synonym: SMD) belongs to the small nuclear ribonucleoprotein core protein family, with molecular weights of the D members: D1,16 kDa; D2, 16.5 kDa and D3 18 kDa. SNRPD3 is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis.

Publications

What published studies show

The SNRPD3 Polyclonal antibody (Cat# 10379-1-AP) has 2 citations. One appears in Translational Oncology (2010), studying genes associated with local aggressiveness and metastatic behavior in soft tissue tumors using IHC. The other is in Biochemical and Biophysical Research Communications (2021), applying CRISPR-based RNA-binding protein mapping in live cells via WB. Both citations involve human samples, covering research fields of oncology and RNA biology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Transl Oncol; Identification of genes associated with local aggressiveness and metastatic behavior in soft tissue tumors.; Authors - Cunha Isabela Werneck IW
human	WB	Biochem Biophys Res Commun; CRISPR-based RNA-binding protein mapping in live cells.; Authors - Baiwen Chen