Tested Applications
Positive WB detected in | MCF7 cells, MCF-7 cells |
Positive IHC detected in | human small intestine tissue, human breast cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
10379-1-AP targets SNRPD3 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0293 Product name: Recombinant human SNRPD3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-119 aa of BC000457 Sequence: EGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRG Predict reactive species |
Full Name | small nuclear ribonucleoprotein D3 polypeptide 18kDa |
Calculated Molecular Weight | 18 kDa |
Observed Molecular Weight | 14 kDa |
GenBank Accession Number | BC000457 |
Gene Symbol | SNRPD3 |
Gene ID (NCBI) | 6634 |
RRID | AB_2286308 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P62318 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Small nuclear ribonucleoprotein D3 polypeptide 18kDa (SNRPD3,synonym: SMD) belongs to the small nuclear ribonucleoprotein core protein family, with molecular weights of the D members: D1,16 kDa; D2, 16.5 kDa and D3 18 kDa. SNRPD3 is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SNRPD3 antibody 10379-1-AP | Download protocol |
IHC protocol for SNRPD3 antibody 10379-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Transl Oncol Identification of genes associated with local aggressiveness and metastatic behavior in soft tissue tumors. |