Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26727-1-AP targets SNX10 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24977 Product name: Recombinant human SNX10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 124-201 aa of BC034992 Sequence: HLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSHGCKVNTAPQES Predict reactive species |
Full Name | sorting nexin 10 |
Calculated Molecular Weight | 201 aa, 24 kDa |
Observed Molecular Weight | 25 kDa |
GenBank Accession Number | BC034992 |
Gene Symbol | SNX10 |
Gene ID (NCBI) | 29887 |
RRID | AB_3085897 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y5X0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins classified by the presence of a phospholipid-binding motif PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. Mutations in SNX10 (Sorting nexin-10) have been found to account for approximately 4% of all human autosomal recessive osteopetrosis (ARO) that is a genetically heterogeneous disorder caused by reduced bone resorption by osteoclasts (PMID: 23280965; PMID: 28592808).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for SNX10 antibody 26727-1-AP | Download protocol |
WB protocol for SNX10 antibody 26727-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |