Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26727-1-AP targets SNX10 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24977 Product name: Recombinant human SNX10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 124-201 aa of BC034992 Sequence: HLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSHGCKVNTAPQES Predict reactive species |
| Full Name | sorting nexin 10 |
| Calculated Molecular Weight | 201 aa, 24 kDa |
| Observed Molecular Weight | 25 kDa |
| GenBank Accession Number | BC034992 |
| Gene Symbol | SNX10 |
| Gene ID (NCBI) | 29887 |
| RRID | AB_3085897 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5X0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins classified by the presence of a phospholipid-binding motif PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. Mutations in SNX10 (Sorting nexin-10) have been found to account for approximately 4% of all human autosomal recessive osteopetrosis (ARO) that is a genetically heterogeneous disorder caused by reduced bone resorption by osteoclasts (PMID: 23280965; PMID: 28592808).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SNX10 antibody 26727-1-AP | Download protocol |
| WB protocol for SNX10 antibody 26727-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





