SOAT1/ACAT1 Polyclonal antibody

• 

  WB analysis using 29369-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29369-1-AP (SOAT1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 29369-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 29369-1-AP (SOAT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 29369-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SOAT1 antibody (29369-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• 

  IF Staining of HepG2 using 29369-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SOAT1/ACAT1 antibody (29369-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

SOAT1/ACAT1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29369-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SOAT1, ACACT, ACAT, ACAT-1, Acyl-coenzyme A:cholesterol acyltransferase 1

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, SW480 cells, mouse liver tiisue, rat liver tissue
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29369-1-AP targets SOAT1/ACAT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30945

  Product name: Recombinant human SOAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of BC028940

  Sequence: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRT

• Full Name: sterol O-acyltransferase 1
• Calculated Molecular Weight: 550 aa, 65 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC028940
• Gene Symbol: SOAT1/ACAT1
• Gene ID (NCBI): 6646
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35610
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SOAT1 (Sterol O-acyltransferase 1), also known as ACAT1 (Acyl-Coenzyme A: cholesterol acyltransferase 1), is a crucial endoplasmic reticulum-resident enzyme that plays a central role in cellular cholesterol homeostasis. Its primary function is to catalyze the esterification of free cholesterol with long-chain fatty acids, forming cholesteryl esters. This process serves two key purposes: it prevents the toxic buildup of free cholesterol in cellular membranes and creates neutral lipid droplets for cholesterol storage. SOAT1 is ubiquitously expressed, with high activity in the steroidogenic tissues, and macrophages. Due to its role in facilitating cholesterol ester accumulation in macrophages and its overexpression in various cancers, SOAT1 has emerged as a promising therapeutic target for the treatment of atherosclerosis, neurodegenerative diseases, and cancer.