SOCS2 Monoclonal antibody, PBS Only (Detector)

SOCS2 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60601-2-PBS
Clone No.1B12E2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60601-2-PBS targets SOCS2 as part of a matched antibody pair:

MP50857-1: 60601-1-PBS capture and 60601-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9317

Product name: Recombinant human SOCS2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-198 aa of BC010399

Sequence: MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV

Predict reactive species
Full Name suppressor of cytokine signaling 2
Calculated Molecular Weight 198 aa, 22 kDa
GenBank Accession NumberBC010399
Gene Symbol SOCS2
Gene ID (NCBI) 8835
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G Magarose purification
UNIPROT IDO14508
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...