SORBS1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP01871-1

  Sandwich ELISA standard curve of MP01871-1, Human SORBS1 Recombinant Matched Antibody Pair - PBS only. 85158-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag4828. 85158-3-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL

• 

  Sample test of MP01871-1

  The mean SORBS1 concentration was determined to be 43.68 ng/mL in 3T3-L1 cell extract based on a 1.3 mg/mL extract load and 250.85 ng/mL in mouse liver tissue extract based on a 3.7 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP01871-1

  Cytometric bead array standard curve of MP01871-1, SORBS1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85158-2-PBS. Detection antibody: 85158-3-PBS. Standard: Ag4828. Range: 0.781-100 ng/mL.

SORBS1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85158-2-PBS

Clone No.242797G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Sorbin and SH3 domain-containing protein 1, SORB1, SH3D5, c-Cbl-associated protein, CAP

---

Product Information

85158-2-PBS targets SORBS1 as part of a matched antibody pair:

MP01871-1: 85158-2-PBS capture and 85158-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

MP01871-2: 85158-2-PBS capture and 85158-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4828

  Product name: Recombinant human SORBS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC042612

  Sequence: MSSECDGGSKAVMNGLAPGSNGQDKDMDPTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPDEWRLSSSADANGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPPTPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDS

• Full Name: sorbin and SH3 domain containing 1
• Calculated Molecular Weight: 1292 aa, 142 kDa
• GenBank Accession Number: BC042612
• Gene Symbol: SORBS1
• Gene ID (NCBI): 10580
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BX66
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.