SOX1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• SOX1 Monoclonal antibody (67994-1-Ig)

SOX1 Monoclonal Antibody for WB, ELISA

Cat No. 67994-1-Ig Copied!

Clone No. 1C10H2

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse and More (1)

Applications

WB, IF, ELISA

Synonyms

SOX1, Transcription factor SOX 1

• 

  WB analysis of HUVEC using 67994-1-Ig

  HUVEC cells were subjected to SDS PAGE followed by western blot with 67994-1-Ig (SOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of ATDC-5 using 67994-1-Ig

  ATDC-5 cells were subjected to SDS PAGE followed by western blot with 67994-1-Ig (SOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NCCIT using 67994-1-Ig

  NCCIT cells were subjected to SDS PAGE followed by western blot with 67994-1-Ig (SOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HaCaT using 67994-1-Ig

  HaCaT cells were subjected to SDS PAGE followed by western blot with 67994-1-Ig (SOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 67994-1-Ig

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 67994-1-Ig (SOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SOX1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HUVEC cells, HaCaT cells, COLO 320 cells, NCCIT cells, ATDC-5 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67994-1-Ig targets SOX1 in WB, IF, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31118

  Product name: Recombinant human SOX1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 318-391 aa of NM_005986

  Sequence: VKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI

• Full Name: SRY (sex determining region Y)-box 1
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: NM_005986
• Gene Symbol: SOX1
• Gene ID (NCBI): 6656
• RRID: AB_2918743
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00570
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SOX1 Monoclonal antibody (1C10H2), catalog number 67994-1-Ig, has 1 citation to date. The cited publication appeared in Biology (Basel) (2025, IF 4.3), investigating stage-specific alternative polyadenylation during human neural differentiation using integrated long- and short-read sequencing. The research field encompasses RNA biology, alternative polyadenylation, and neural stem cell differentiation. The antibody was applied in immunofluorescence (IF) on human samples in this study.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Biology (Basel); Stage-Specific Alternative Polyadenylation During Human Neural Differentiation Revealed by Integrated Long- and Short-Read Sequencing.; Authors - Zheqi Lou