SOX1 Monoclonal antibody

• 

  WB analysis of HUVEC using 67994-1-Ig

  HUVEC cells were subjected to SDS PAGE followed by western blot with 67994-1-Ig (SOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of ATDC-5 using 67994-1-Ig

  ATDC-5 cells were subjected to SDS PAGE followed by western blot with 67994-1-Ig (SOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCCIT using 67994-1-Ig

  NCCIT cells were subjected to SDS PAGE followed by western blot with 67994-1-Ig (SOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HaCaT using 67994-1-Ig

  HaCaT cells were subjected to SDS PAGE followed by western blot with 67994-1-Ig (SOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 67994-1-Ig

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 67994-1-Ig (SOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

SOX1 Monoclonal Antibody for WB, ELISA

Cat No. 67994-1-Ig

Clone No.1C10H2

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse

Applications

WB, ELISA

Synonyms

SOX1, Transcription factor SOX 1

---

Tested Applications

• Positive WB detected in: HUVEC cells, HaCaT cells, COLO 320 cells, NCCIT cells, ATDC-5 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67994-1-Ig targets SOX1 in WB, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31118

  Product name: Recombinant human SOX1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 318-391 aa of NM_005986

  Sequence: VKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI

• Full Name: SRY (sex determining region Y)-box 1
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: NM_005986
• Gene Symbol: SOX1
• Gene ID (NCBI): 6656
• RRID: AB_2918743
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00570
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.