SOX10 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 10422-1-AP (same clone as 10422-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10422-1-AP (SOX10 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10422-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDA-MB-453 using 10422-1-AP (same clone as 10422-1-PBS)

  WB result of SOX10 antibody (10422-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SOX10 transfected MDA-MB-453 cells. This data was developed using the same antibody clone with 10422-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 10422-1-AP (same clone as 10422-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 10422-1-AP (SOX10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10422-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse small intestine using 10422-1-AP (same clone as 10422-1-PBS)

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 10422-1-AP (SOX10 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10422-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse colon using 10422-1-AP (same clone as 10422-1-PBS)

  IP result of anti-SOX10 (IP:10422-1-AP, 4ug; Detection:10422-1-AP 1:2000) with mouse colon tissue lysate 4000 ug. This data was developed using the same antibody clone with 10422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10422-1-AP (same clone as 10422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10422-1-AP (SOX10 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10422-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 10422-1-AP (same clone as 10422-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using SOX10 antibody (10422-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 10422-1-PBS in a different storage buffer formulation.

• 

  FC experiment of C6 using 10422-1-AP (same clone as 10422-1-PBS)

  1X10^6 C6 cells were intracellularly stained with 0.4 ug Anti-Human SOX10 (10422-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 10422-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SOX10 Polyclonal Antibody for WB, IHC, IF-Fro, FC (Intra), IP, Indirect ELISA

Cat No. 10422-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-Fro, FC (Intra), IP, Indirect ELISA

Synonyms

DOM, PCWH, SRY-box transcription factor 9, Transcription factor SOX 10, Transcription factor SOX-10

---

Product Information

10422-1-PBS targets SOX10 in WB, IHC, IF-Fro, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0673

  Product name: Recombinant human SOX10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 267-466 aa of BC002824

  Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP

• Full Name: SRY (sex determining region Y)-box 10
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC002824
• Gene Symbol: SOX10
• Gene ID (NCBI): 6663
• RRID: AB_2195371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56693
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842)