SOX10 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SOX10 Polyclonal antibody (10422-1-AP)

• Featured Product
• KD/KO Validated

SOX10 Polyclonal Antibody for WB, IHC, IF-Fro, FC (Intra), IP, ELISA

Cat No. 10422-1-AP Copied!

Publications (39)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-Fro, FC (Intra), IP, CoIP, ELISA

Synonyms

DOM, PCWH, SRY-box transcription factor 9, Transcription factor SOX 10, Transcription factor SOX-10

• 

  WB analysis of mouse brain using 10422-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10422-1-AP (SOX10 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MDA-MB-453 using 10422-1-AP

  WB result of SOX10 antibody (10422-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SOX10 transfected MDA-MB-453 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 10422-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 10422-1-AP (SOX10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse small intestine using 10422-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 10422-1-AP (SOX10 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse colon using 10422-1-AP

  IP result of anti-SOX10 (IP:10422-1-AP, 4ug; Detection:10422-1-AP 1:2000) with mouse colon tissue lysate 4000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 10422-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10422-1-AP (SOX10 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 10422-1-AP

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using SOX10 antibody (10422-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of C6 using 10422-1-AP

  1X10^6 C6 cells were intracellularly stained with 0.4 ug Anti-Human SOX10 (10422-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SOX10 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, MDA-MB-453 cells, mouse small intestine tissue, SH-SY5Y cells
• Positive IP detected in: mouse colon tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-Fro detected in: mouse brain tissue
• Positive FC (Intra) detected in: C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10422-1-AP targets SOX10 in WB, IHC, IF-Fro, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0673

  Product name: Recombinant human SOX10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 267-466 aa of BC002824

  Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP

• Full Name: SRY (sex determining region Y)-box 10
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC002824
• Gene Symbol: SOX10
• Gene ID (NCBI): 6663
• RRID: AB_2195371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56693
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842)

Publications

What published studies show

SOX10 Rabbit mAb (Cat# 10422-1-AP) has 39 citations published in journals including Nature, Nature Communications, Neuron, Development, Dev Cell, Neuro-Oncology, Journal of Neuroscience, Journal of Neurochemistry, Experimental Neurology, Scientific Reports, Cell Death Discovery, International Journal of Molecular Sciences, and others. Research fields span neuroscience (Schwann cells, neural crest, myelination), neurodegeneration (Parkinson's/Alzheimer's), oncology (melanoma, glioblastoma, breast cancer), stem cell biology (hair follicle-derived), developmental biology, stroke, and dermatology.

Automatically generated from the 39 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Nature; Regulation of intestinal immunity and tissue repair by enteric glia; Authors - Fränze Progatzky
mouse	IF	Nat Commun; A branching model of lineage differentiation underpinning the neurogenic potential of enteric glia; Authors - Anna Laddach
mouse	IF	Neuron; Gut-induced alpha-Synuclein and Tau propagation initiate Parkinson's and Alzheimer's disease co-pathology and behavior impairments; Authors - Jie Xiang
human	IHC	Neuro Oncol; VGLL-fusions define a new class of intraparenchymal CNS schwannoma; Authors - Simone Schmid
human	WB,IF	Int J Biol Sci; The SOX10-ACAT2-Cholesterol Synthesis Axis Is Required for Melanoma Proliferation.; Authors - Lihua Wang ; KD Validated
human	IF	Cell Death Discov; NeuroD4 converts glioblastoma cells into neuron-like cells through the SLC7A11-GSH-GPX4 antioxidant axis; Authors - Hao Wang