• Featured Product
  • KD/KO Validated

SOX10 Polyclonal antibody

SOX10 Polyclonal Antibody for WB, IHC, IF-Fro, FC (Intra), IP, ELISA
Cat No. 10422-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-Fro, FC (Intra), IP, CoIP, ELISA

DOM, PCWH, SRY-box transcription factor 9, Transcription factor SOX 10, Transcription factor SOX-10

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, MDA-MB-453 cells, mouse small intestine tissue, SH-SY5Y cells
Positive IP detected inmouse colon tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-Fro detected inmouse brain tissue
Positive FC (Intra) detected inC6 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10422-1-AP targets SOX10 in WB, IHC, IF-Fro, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0673

Product name: Recombinant human SOX10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 267-466 aa of BC002824

Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP

Predict reactive species
Full Name SRY (sex determining region Y)-box 10
Calculated Molecular Weight 50 kDa
Observed Molecular Weight 50-60 kDa
GenBank Accession NumberBC002824
Gene Symbol SOX10
Gene ID (NCBI) 6663
RRIDAB_2195371
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP56693
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842)

Protocols

Product Specific Protocols
FC protocol for SOX10 antibody 10422-1-APDownload protocol
IF protocol for SOX10 antibody 10422-1-APDownload protocol
IHC protocol for SOX10 antibody 10422-1-APDownload protocol
IP protocol for SOX10 antibody 10422-1-APDownload protocol
WB protocol for SOX10 antibody 10422-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Nature

Regulation of intestinal immunity and tissue repair by enteric glia

Authors - Fränze Progatzky
mouseIF

Neuron

Gut-induced alpha-Synuclein and Tau propagation initiate Parkinson's and Alzheimer's disease co-pathology and behavior impairments

Authors - Jie Xiang
rat,mouseWB,IF,CoIP

Dev Cell

Nuclear import carrier Hikeshi cooperates with HSP70 to promote murine oligodendrocyte differentiation and CNS myelination

Authors - Li Li
humanIF

Front Immunol

Machine learning-based identification of SOX10 as an immune regulator of macrophage in gliomas

Authors - Gelei Xiao
mouseWB

J Cereb Blood Flow Metab

The role of serum/glucocorticoid-regulated kinase 1 in brain function following cerebral ischemia

Authors - Celeste Yin-Chieh Wu
ratWB,IF

J Neurosci

H3K27 Trimethylation-Mediated Downregulation of miR-216a-3p in Sensory Neurons Regulates Neuropathic Pain Behaviors via Targeting STIM1

Authors - Yufang Sun
Loading...
||
New chat Able
正在加载,请稍候...