SOX11 Polyclonal antibody, PBS Only

• 

  WB analysis using 29395-1-AP (same clone as 29395-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29395-1-AP (SOX11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29395-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SOX11 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29395-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

29395-1-PBS targets SOX11 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30020

  Product name: Recombinant human SOX11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 125-310 aa of NM_003108

  Sequence: KMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDEDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSR

• Full Name: SRY (sex determining region Y)-box 11
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_003108
• Gene Symbol: SOX11
• Gene ID (NCBI): 6664
• RRID: AB_2918291
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35716
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.