SOX11 Polyclonal antibody

• 

  WB analysis using 29395-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29395-1-AP (SOX11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

SOX11 Polyclonal Antibody for WB, ELISA

Cat No. 29395-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IF, ELISA

Synonyms

SOX11, Transcription factor SOX 11

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, Y79 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IF: See 1 publications below

Product Information

29395-1-AP targets SOX11 in WB, IF, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30020

  Product name: Recombinant human SOX11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 125-310 aa of NM_003108

  Sequence: KMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDEDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSR

• Full Name: SRY (sex determining region Y)-box 11
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_003108
• Gene Symbol: SOX11
• Gene ID (NCBI): 6664
• RRID: AB_2918291
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35716
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; EIF3D safeguards the homeostasis of key signaling pathways in human primed pluripotency; Authors - Chikako Okubo
human	WB	Stem Cells Int; lncRNA CYTOR Facilitates Osteogenic Differentiation of Human Periodontal Ligament Stem Cells by Modulating SOX11 via Sponging miR-6512-3p; Authors - Shaoqin Tu ; KD Validated
human	IF	Exp Mol Med; Single-cell RNA sequencing and spatial transcriptomics of esophageal squamous cell carcinoma with lymph node metastases; Authors - Wei Guo
human	WB	J Dent Sci; miR-508-5p suppresses osteogenic differentiation of human periodontal ligament stem cells via targeting sex-determining region Y-related HMG-box 11; Authors - Jing Guo