Tested Applications
Positive IHC detected in | mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse embryo tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IF | See 1 publications below |
Product Information
25415-1-AP targets SOX15 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22032 Product name: Recombinant human SOX15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 124-233 aa of BC000985 Sequence: AKSSGAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL Predict reactive species |
Full Name | SRY (sex determining region Y)-box 15 |
Calculated Molecular Weight | 25 kDa |
GenBank Accession Number | BC000985 |
Gene Symbol | SOX15 |
Gene ID (NCBI) | 6665 |
RRID | AB_2880067 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O60248 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SOX15, also named as SOX12, SOX20, is a 223 amino acid protein, which contains one HMG box DNA-binding domain. SOX15 is widely expressed in fetal and adult tissues and highest level is found in fetal spinal cord and adult brain and testis. SOX15 is a candidate tumor suppressor in pancreatic cancer with a potential role in Wnt/β-catenin signaling. Sox15 is required for skeletal muscle regeneration and is up regulated in the embryonic mouse testis.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for SOX15 antibody 25415-1-AP | Download protocol |
IF protocol for SOX15 antibody 25415-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Biol Chem Transcription factor SOX15 regulates stem cell pluripotency and promotes neural fate during differentiation by activating the neurogenic gene Hes5
| ||
Oncogene CircVPS8 promotes the malignant phenotype and inhibits ferroptosis of glioma stem cells by acting as a scaffold for MKRN1, SOX15 and HNF4A | ||
MicroPubl Biol A commonly used anti-SOX15 antibody fails to demonstrate specificity in mouse embryos |