Tested Applications
| Positive IHC detected in | mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF-P detected in | mouse embryo tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below | 
| WB | See 2 publications below | 
| IF | See 1 publications below | 
Product Information
25415-1-AP targets SOX15 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag22032 Product name: Recombinant human SOX15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 124-233 aa of BC000985 Sequence: AKSSGAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL Predict reactive species | 
                                    
| Full Name | SRY (sex determining region Y)-box 15 | 
| Calculated Molecular Weight | 25 kDa | 
| GenBank Accession Number | BC000985 | 
| Gene Symbol | SOX15 | 
| Gene ID (NCBI) | 6665 | 
| RRID | AB_2880067 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | O60248 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
SOX15, also named as SOX12, SOX20, is a 223 amino acid protein, which contains one HMG box DNA-binding domain. SOX15 is widely expressed in fetal and adult tissues and highest level is found in fetal spinal cord and adult brain and testis. SOX15 is a candidate tumor suppressor in pancreatic cancer with a potential role in Wnt/β-catenin signaling. Sox15 is required for skeletal muscle regeneration and is up regulated in the embryonic mouse testis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SOX15 antibody 25415-1-AP | Download protocol | 
| IHC protocol for SOX15 antibody 25415-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
J Biol Chem Transcription factor SOX15 regulates stem cell pluripotency and promotes neural fate during differentiation by activating the neurogenic gene Hes5
  | ||
Oncogene CircVPS8 promotes the malignant phenotype and inhibits ferroptosis of glioma stem cells by acting as a scaffold for MKRN1, SOX15 and HNF4A | ||
MicroPubl Biol A commonly used anti-SOX15 antibody fails to demonstrate specificity in mouse embryos | 





