Tested Applications
| Positive WB detected in | C6 cells, PC-3 cells, mouse embryo |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 5 publications below |
| IF | See 16 publications below |
Product Information
24903-1-AP targets SOX17 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19157 Product name: Recombinant human SOX17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC111365 Sequence: MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGES Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 17 |
| Calculated Molecular Weight | 414 aa, 44 kDa |
| Observed Molecular Weight | 44 kDa |
| GenBank Accession Number | BC111365 |
| Gene Symbol | SOX17 |
| Gene ID (NCBI) | 64321 |
| RRID | AB_2879789 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H6I2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transcription factor SOX 17 (SOX17) also named as SRY box 17 is a 414 amino acid protein, which contains one Sox C-terminal domain and one HMG box DNA-binding domain. SOX17 as a transcription regulator binds target promoter DNA and bend the DNA via WNT3A. SOX17 is a marker of endodermal cells and a transcriptional regulator containing a DNA binding domain called the HMG box. In mouse embryos, SOX17 plays critical roles in the growth and differentiation of definitive endodermal cells (PMID: 11973269), the remodeling of endothelial cells (PMID: 16895970), hindgut endoderm expansion with localization of primordial germ cells (PMID: 19371732), and gallbladder/bile duct formation (PMID: 19913509).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SOX17 antibody 24903-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mater Today Bio Nanofiber-microwell cell culture system for spatially patterned differentiation of pluripotent stem cells in 3D | ||
Stem Cell Reports Phosphorylation of Threonine343 Is Crucial for OCT4 Interaction with SOX2 in the Maintenance of Mouse Embryonic Stem Cell Pluripotency. | ||
Front Cell Dev Biol ADNP Controls Gene Expression Through Local Chromatin Architecture by Association With BRG1 and CHD4. | ||
Stem Cell Res Establishment of an arrhythmogenic right ventricular cardiomyopathy derived iPSC cell line (USFi004-A) carrying a heterozygous mutation in PKP2 (c.1799delA). | ||
Stem Cell Res Generation of a heterozygous FLNC mutation-carrying human iPSC line, USFi002-A, for modeling dilated cardiomyopathy. |



