Product Information
83059-5-PBS targets SOX2 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0612 Product name: Recombinant human SOX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 59-118 aa of BC013923 Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 2 |
| Calculated Molecular Weight | 34 kDa |
| GenBank Accession Number | BC013923 |
| Gene Symbol | SOX2 |
| Gene ID (NCBI) | 6657 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P48431 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Sox2, also known as SRY (sex determining region Y)-box 2, is a transcription factor essential for maintaining self-renewal of undifferentiated ES cells and is one of the key transcription factors used to reprogram mouse and human fibroblasts to a pluripotent state. Sox2 expressed in undifferentiated pluripotent stem cells and germ cells during development. Affinity purified rabbit anti-Sox2 antibody can be used to demonstrate pluripotency of ES and iPS cells. This antibody is a rabbit polyclonal antibody raised against an internal region of human SOX2. a rare undiferentiated cell population that is intermingled with the Bergmann glia of the adult murine cerebellar cortex, expresses the stem cell markers Sox2 and Nestin, and lacks markers of glial or neuronal diferentiation. Sox2-expressing neural stem cells in the subgranular zone (SGZ) , a well-known stem cell niche of the adult brain.





