Tested Applications
| Positive WB detected in | mouse brain tissue, U-251 cells, rat brain tissue, C6 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83059-6-RR targets SOX2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0612 Product name: Recombinant human SOX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 59-118 aa of BC013923 Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 2 |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 34-43 kDa |
| GenBank Accession Number | BC013923 |
| Gene Symbol | SOX2 |
| Gene ID (NCBI) | 6657 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P48431 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sox2, also known as SRY (sex determining region Y)-box 2, is a transcription factor essential for maintaining self-renewal of undifferentiated ES cells and is one of the key transcription factors used to reprogram mouse and human fibroblasts to a pluripotent state. Sox2 expressed in undifferentiated pluripotent stem cells and germ cells during development. A rare undiferentiated cell population that is intermingled with the Bergmann glia of the adult murine cerebellar cortex, expresses the stem cell markers Sox2 and Nestin, and lacks markers of glial or neuronal diferentiation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SOX2 antibody 83059-6-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



