SOX2 Recombinant monoclonal antibody

• 

  WB analysis using 83059-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83059-6-RR (SOX2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83059-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83059-6-RR (SOX2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

SOX2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83059-6-RR

Clone No.252889F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ANOP3, MCOPS 3, MCOPS3, SOX 2, Transcription factor SOX 2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, U-251 cells, rat brain tissue, C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83059-6-RR targets SOX2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0612

  Product name: Recombinant human SOX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 59-118 aa of BC013923

  Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT

• Full Name: SRY (sex determining region Y)-box 2
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34-43 kDa
• GenBank Accession Number: BC013923
• Gene Symbol: SOX2
• Gene ID (NCBI): 6657
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48431
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sox2, also known as SRY (sex determining region Y)-box 2, is a transcription factor essential for maintaining self-renewal of undifferentiated ES cells and is one of the key transcription factors used to reprogram mouse and human fibroblasts to a pluripotent state. Sox2 expressed in undifferentiated pluripotent stem cells and germ cells during development. A rare undiferentiated cell population that is intermingled with the Bergmann glia of the adult murine cerebellar cortex, expresses the stem cell markers Sox2 and Nestin, and lacks markers of glial or neuronal diferentiation.