SP7 Recombinant monoclonal antibody

• 

  WB analysis using 85934-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85934-1-RR (SP7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 85934-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85934-1-RR against Human SP7 were performed. The affinity constant is 1.10 nM.

SP7 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85934-1-RR

Clone No.250286C5

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

osterix, OSX, Sp7 transcription factor, Transcription factor Sp7, Zinc finger protein osterix

---

Tested Applications

• Positive WB detected in: Saos-2 cells, U2OS cells, MG-63 cells, Sp2/0 cells, mouse spinal cord tissue, mouse testis tissue, rat brain tiisue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

85934-1-RR targets SP7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29889

  Product name: Recombinant human SP7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-179 aa of NM_152860

  Sequence: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTMGDAYPAPFTSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQ

• Full Name: Sp7 transcription factor
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_152860
• Gene Symbol: SP7
• Gene ID (NCBI): 121340
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TDD2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sp7 is identified in several tissues, including bone, tooth, brain, and the reproductive tract (PMID: 11792318, 33135214, 36881265). In bone, Sp7 is expressed at multiple stages throughout the mesenchymal bone lineage and plays different roles in different osteocytes (PMID: 36881265). SP7 regulates osteoblast differentiation and bone formation through osteoblast target genes by recognizing AT-rich region. In osteocytes, SP7 regulates osteocyte maturation and intracortical remodeling through osteocyte target genes by recognizing TGA(G/T) TCA motif. SP7 also regulates chondrocyte differentiation and endochondral ossification (36881265).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Int Immunopharmacol; Periostin ameliorates impaired osteogenic differentiation of bone marrow mesenchymal stem cells from T2DM rats via modulating autophagy and cellular senescence.; Authors - Yanling Mi