SP7 Recombinant monoclonal antibody, PBS Only

SP7 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85934-1-PBS
Clone No.250286C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

osterix, OSX, Sp7 transcription factor, Transcription factor Sp7, Zinc finger protein osterix

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85934-1-PBS targets SP7 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29889

Product name: Recombinant human SP7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-179 aa of NM_152860

Sequence: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTMGDAYPAPFTSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQ

Predict reactive species
Full Name Sp7 transcription factor
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberNM_152860
Gene Symbol SP7
Gene ID (NCBI) 121340
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TDD2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Sp7 is identified in several tissues, including bone, tooth, brain, and the reproductive tract (PMID: 11792318, 33135214, 36881265). In bone, Sp7 is expressed at multiple stages throughout the mesenchymal bone lineage and plays different roles in different osteocytes (PMID: 36881265). SP7 regulates osteoblast differentiation and bone formation through osteoblast target genes by recognizing AT-rich region. In osteocytes, SP7 regulates osteocyte maturation and intracortical remodeling through osteocyte target genes by recognizing TGA(G/T) TCA motif. SP7 also regulates chondrocyte differentiation and endochondral ossification (36881265).

Loading...
||
New chat Able
正在加载,请稍候...