Tested Applications
Positive IHC detected in | human oesophagus cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21155-1-AP targets SPINK7 in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15727 Product name: Recombinant human SPINK7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC109385 Sequence: MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC Predict reactive species |
Full Name | serine peptidase inhibitor, Kazal type 7 (putative) |
Calculated Molecular Weight | 85 aa, 9 kDa |
GenBank Accession Number | BC109385 |
Gene Symbol | SPINK7 |
Gene ID (NCBI) | 84651 |
RRID | AB_3085640 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P58062 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SPINK7, also named esophageal cancer-related gene 2 (ECRG 2), is a member of the SPINK protease inhibitor family. It is thought to function as a tumor suppressor gene regulating the protease cascades during carcinogenesis and invasion of esophageal cancer by regulation of migration through urokinase-type plasmin activator/plasmin MAP kinase pathway.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for SPINK7 antibody 21155-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |