Tested Applications
| Positive WB detected in | mouse testis tissue, human testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15509-1-AP targets SPO11 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4340 Product name: Recombinant human SPO11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-358 aa of BC033591 Sequence: MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASRFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI Predict reactive species |
| Full Name | SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae) |
| Calculated Molecular Weight | 45 kDa |
| Observed Molecular Weight | 55-70 kDa |
| GenBank Accession Number | BC033591 |
| Gene Symbol | SPO11 |
| Gene ID (NCBI) | 23626 |
| RRID | AB_10639508 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5K1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Spo11 is a protein used in a complex along with Mre11 and Rad50 during meiotic recombination. It is also involved in the creation of double stranded breaks in the DNA in the early stages of this process. Several transcript variants encoding different isoforms have been found for this gene.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SPO11 antibody 15509-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



