Tested Applications
| Positive IHC detected in | human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 2 publications below |
Product Information
11959-1-AP targets SPRR1B in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2563 Product name: Recombinant human SPRR1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC056240 Sequence: MSSQQQKQPCIPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK Predict reactive species |
| Full Name | small proline-rich protein 1B (cornifin) |
| Calculated Molecular Weight | 89 aa, 10 kDa |
| GenBank Accession Number | BC056240 |
| Gene Symbol | SPRR1B |
| Gene ID (NCBI) | 6699 |
| RRID | AB_2877807 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P22528 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
This protein functions as a component of the cross-linked envelope in squamous differentiating cells. It runs as a 15-kDa protein in unreducing SDS PAGE, whereas under reducing conditions it runs as 23 kDa one.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SPRR1B antibody 11959-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Discov Single-cell atlas of keratoconus corneas revealed aberrant transcriptional signatures and implicated mechanical stretch as a trigger for keratoconus pathogenesis. | ||
Front Oncol Long Noncoding RNA HAGLROS Promotes the Malignant Progression of Bladder Cancer by Regulating the miR-330-5p/SPRR1B Axis. | ||
Adv Sci (Weinh) Real-Time Evolutionary Landscape of the Bronchial Epithelium and Corresponding Dynamic Immune Cell Alterations in Lung Squamous Cell Carcinogenesis |







