SRA1 Polyclonal antibody

SRA1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24655-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Steroid receptor RNA activator protein, Steroid receptor RNA activator 1, SRAP, PP7684

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA2780 cells, HEK-293 cells
Positive IHC detected inhuman breast cancer tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24655-1-AP targets SRA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20082

Product name: Recombinant human SRA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-209 aa of BC067895

Sequence: GNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLF

Predict reactive species
Full Name steroid receptor RNA activator 1
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 30 kDa, 33 kDa
GenBank Accession NumberBC067895
Gene Symbol SRA1
Gene ID (NCBI) 10011
RRIDAB_2879657
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HD15
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Steroid receptor RNA activator 1 (SRA1), also known as seroid receptor RNA activator protein (SRAP) or SRA, is involved in modulating the activity of multiple transcription factors including the estrogen receptor (ER) (PMID: 20398657). It may play a role in tumorigenesis (PMID: 16152589). The SRA1 gene encodes both SRA1 protein and a non-coding functional RNA that functions as part of a ribonucleoprotein complex activating steroid receptor induced transcription. This polyclonal antibody recognizes endogenous SRA1 isoforms which migrate as a doublet on SDS-PAGE gels (PMID: 12565891; 23907597).

Protocols

Product Specific Protocols
WB protocol for SRA1 antibody 24655-1-APDownload protocol
IHC protocol for SRA1 antibody 24655-1-APDownload protocol
IF protocol for SRA1 antibody 24655-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Adv Sci (Weinh)

Pyruvate Carboxylase in Macrophages Aggravates Atherosclerosis by Regulating Metabolism Reprogramming to Promote Inflammatory Responses Through the Hypoxia-Inducible Factor-1 Signaling Pathway

Authors - Ling-Na Zhao
mouseWB

Free Radic Biol Med

Up-regulation of thioredoxin system by puerarin inhibits lipid uptake in macrophages

Authors - Wenchao Li,
human,mouseWB

Phytomedicine

Rice bran active peptide (RBAP) inhibited macrophage differentiation to foam cell and atherosclerosis in mice via regulating cholesterol efflux

Authors - Jianfei Mu
human, mouseWB

Arterioscler Thromb Vasc Biol

RP5-833A20.1/miR-382-5p/NFIA-Dependent Signal Transduction Pathway Contributes to the Regulation of Cholesterol Homeostasis and Inflammatory Reaction.

Authors - Yan-Wei Hu
humanWB

J Lipid Res

A lincRNA-DYNLRB2-2/GPR119/GLP-1R/ABCA1-dependent Signal Transduction Pathway Is Essential for the Regulation of Cholesterol Homeostasis and Inflammatory Reactions.

Authors - Yan-Wei Hu
humanWB

J Lipid Res

VNN1 Promotes Atherosclerosis Progression in apoE Deficiency Mice Fed a High Fat High Cholesterol Diet.

Authors - Yan-Wei Hu
Loading...