CoraLite® Plus 488-conjugated SRA1 Polyclonal antibody

SRA1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-24655

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Steroid receptor RNA activator protein, Steroid receptor RNA activator 1, SRAP, PP7684

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-24655 targets SRA1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20082

Product name: Recombinant human SRA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-209 aa of BC067895

Sequence: GNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLF

Predict reactive species
Full Name steroid receptor RNA activator 1
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 30 kDa, 33 kDa
GenBank Accession NumberBC067895
Gene Symbol SRA1
Gene ID (NCBI) 10011
RRIDAB_3672771
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HD15
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Steroid receptor RNA activator 1 (SRA1), also known as seroid receptor RNA activator protein (SRAP) or SRA, is involved in modulating the activity of multiple transcription factors including the estrogen receptor (ER) (PMID: 20398657). It may play a role in tumorigenesis (PMID: 16152589). The SRA1 gene encodes both SRA1 protein and a non-coding functional RNA that functions as part of a ribonucleoprotein complex activating steroid receptor induced transcription. This polyclonal antibody recognizes endogenous SRA1 isoforms which migrate as a doublet on SDS-PAGE gels (PMID: 12565891; 23907597).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SRA1 antibody CL488-24655Download protocol
FC protocol for CL Plus 488 SRA1 antibody CL488-24655Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...