SREBF2 Polyclonal antibody, PBS Only

• 

  WB analysis using 28212-1-AP (same clone as 28212-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28212-1-AP (SREBF2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28212-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28212-1-AP (same clone as 28212-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28212-1-AP (SREBF2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28212-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28212-1-AP (same clone as 28212-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28212-1-AP (SREBF2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28212-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 28212-1-AP (same clone as 28212-1-PBS)

  IP result of anti-SREBF2 (IP:28212-1-AP, 4ug; Detection:28212-1-AP 1:1500) with HeLa cells lysate 1200 ug. This data was developed using the same antibody clone with 28212-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SREBF2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 28212-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

bHLHd2, Class D basic helix-loop-helix protein 2, Processed sterol regulatory element-binding protein 2, SREBF 2, SREBP 2

---

Product Information

28212-1-PBS targets SREBF2 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28205

  Product name: Recombinant human SREBF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 375-479 aa of BC056158

  Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR

• Full Name: sterol regulatory element binding transcription factor 2
• Calculated Molecular Weight: 124 kDa
• Observed Molecular Weight: 73-75 kDa, 120-130 kDa
• GenBank Accession Number: BC056158
• Gene Symbol: SREBF2
• Gene ID (NCBI): 6721
• RRID: AB_2881091
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12772
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SREBF2,also named as BHLHD2, is a 1141 amino acid protein, which contains 1 bHLH domain and belongs to the SREBP family. SREBF2 localizes in the endoplasmic reticulum membrane and is ubiquitously expressed in adult and fetal tissues. SREBF2 as a transcriptional activator is required for lipid homeostasis. SREBF2 expression is dynamically regulated in response to nutritional and hormonal cues. SREBF2 exists two isoform with molecular weight 124 kDa and 73 kDa.