Tested Applications
Positive WB detected in | A431 cells, MCF-7 cells, K-562 cells, HEK-293 cells, HeLa cells, NIH/3T3 cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 20 publications below |
IHC | See 2 publications below |
IF | See 2 publications below |
IP | See 3 publications below |
CoIP | See 3 publications below |
ChIP | See 2 publications below |
Product Information
16821-1-AP targets SRF in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag10386 Product name: Recombinant human SRF protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-348 aa of BC048211 Sequence: MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPG Predict reactive species |
Full Name | serum response factor (c-fos serum response element-binding transcription factor) |
Calculated Molecular Weight | 508 aa, 52 kDa |
Observed Molecular Weight | 65-70 kDa, 40 kDa |
GenBank Accession Number | BC048211 |
Gene Symbol | SRF |
Gene ID (NCBI) | 6722 |
RRID | AB_2194384 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P11831 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Serum response factor (SRF) is a transcription factor that binds the serum response element (SRE), a sequence that mediates the transient response of many cellular genes to growth stimulation. SRF is required for cardiac differentiation and maturation due to the role in cardiac cell growth and muscle gene regulation. The full-length SRF protein is 67 kDa and molecular weight of cleaved fragment is 50 kDa and 20 kDa (PMID: 21769134).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SRF antibody 16821-1-AP | Download protocol |
IHC protocol for SRF antibody 16821-1-AP | Download protocol |
IF protocol for SRF antibody 16821-1-AP | Download protocol |
IP protocol for SRF antibody 16821-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Exp Mol Med Helicobacter pylori CagA-mediated ether lipid biosynthesis promotes ferroptosis susceptibility in gastric cancer
| ||
Cell Mol Life Sci Crip2 affects vascular development by fine-tuning endothelial cell aggregation and proliferation | ||
Am J Respir Cell Mol Biol SRF Expression in Excess Permits a Dual Contractile-Proliferative Phenotype of Airway Smooth Muscle | ||
Cell Physiol Biochem Galectin-3- Mediated Transdifferentiation of Pulmonary Artery Endothelial Cells Contributes to Hypoxic Pulmonary Vascular Remodeling. | ||
Stem Cell Res Ther Activin B-activated Cdc42 signaling plays a key role in regulating adipose-derived mesenchymal stem cells-mediated skin wound healing. | ||
Am J Physiol Lung Cell Mol Physiol Myocardin regulates fibronectin expression and secretion from human pleural mesothelial cells |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Carmen (Verified Customer) (11-29-2024) | Works well IHC set up on the Leica Bond
|