SRF Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SRF Polyclonal antibody (16821-1-AP)

• Featured Product
• KD/KO Validated

SRF Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16821-1-AP

Publications(39)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

Synonyms

Serum response factor, MCM1

• 

  WB analysis of MCF-7 using 16821-1-AP

  WB result of SRF antibody (16821-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SRF transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 16821-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16821-1-AP (SRF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 16821-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16821-1-AP (SRF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 16821-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16821-1-AP (SRF antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 16821-1-AP

  IP result of anti-SRF (IP:16821-1-AP, 3ug; Detection:16821-1-AP 1:1000) with HeLa cells lysate 3000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 16821-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16821-1-AP (SRF antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 16821-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16821-1-AP (SRF antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 16821-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using SRF antibody (16821-1-AP) at dilution of 1:600 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A431 cells, MCF-7 cells, K-562 cells, HEK-293 cells, HeLa cells, NIH/3T3 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16821-1-AP targets SRF in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10386

  Product name: Recombinant human SRF protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-348 aa of BC048211

  Sequence: MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPG

• Full Name: serum response factor (c-fos serum response element-binding transcription factor)
• Calculated Molecular Weight: 508 aa, 52 kDa
• Observed Molecular Weight: 65-70 kDa, 40 kDa
• GenBank Accession Number: BC048211
• Gene Symbol: SRF
• Gene ID (NCBI): 6722
• RRID: AB_2194384
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11831
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Serum response factor (SRF) is a transcription factor that binds the serum response element (SRE), a sequence that mediates the transient response of many cellular genes to growth stimulation. SRF is required for cardiac differentiation and maturation due to the role in cardiac cell growth and muscle gene regulation. The full-length SRF protein is 67 kDa and molecular weight of cleaved fragment is 50 kDa and 20 kDa (PMID: 21769134).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Nat Commun; SREBP1-mediated lipogenesis promotes dedifferentiation and senescence of vascular smooth muscle cells through epigenetic remodeling.; Authors - Bowen Li
rat	WB	Nat Commun; The inner nuclear membrane protein LEMD3 organizes the 3D chromatin architecture to maintain vascular smooth muscle cell identity.; Authors - Wenqiang Li
		Nat Commun; SLC1A5 prevents aortic aneurysm and dissection by glutaminolytic-epigenetic orchestration of vascular smooth muscle cell homeostasis.; Authors - Pinglian Yang
human	WB	Exp Mol Med; Helicobacter pylori CagA-mediated ether lipid biosynthesis promotes ferroptosis susceptibility in gastric cancer; Authors - Yanmei Peng ; KD Validated
mouse	WB,IP,CoIP	Adv Sci (Weinh); TTK Inhibition Alleviates Postinjury Neointimal Formation and Atherosclerosis; Authors - Jie-Hong Wu
		MedComm (2020); Phase Separation-Mediated SRF/P54nrb Transcription Complex Shapes the Vasculature Microenvironment via Upregulating OLFML3 in Glioblastoma.; Authors - Zetao Chen

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Carmen (Verified Customer) (11-29-2024)

Works well IHC set up on the Leica Bond

• Applications: Immunohistochemistry
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Murine pancreatic tumour